SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33169.AGOS_AER140C from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33169.AGOS_AER140C
Domain Number 1 Region: 33-97,131-278
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.88e-32
Family BAR domain 0.014
Further Details:      
 
Domain Number 2 Region: 343-410
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-18
Family SH3-domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 33169.AGOS_AER140C
Sequence length 414
Comment (Eremothecium gossypii)
Sequence
MNELSDQLSQNLKCDITLIGQRVMRAPQLIKDKLDIGFQFKDKSFDVIQETFNHIHNSVL
TLDTECTRFSTQITNLMNHTQNLNRGFQEIISRGAWDNIQVGSPVSPNSVMSPVGRDFSP
AVATPTTKRFNFSKYVDRFQTTIVKIKSDQQQFQTRVVLPLLQLKDLGLRIQKPLEERRN
LVLDINSYSSKVEKYNQRVHTNELTLKGEQKRMKYDKKLEDVRFKYEALNSILKVELQVY
FDLFRDFLSAWFPLYLYITYSLYYNLYQFLGNCPEVRKLLEKSGFSSLAPVSSVVNTSRN
LVEDFHVSFDGAMKHLQSLNIINYKKLCALVYAGENDDGSRANAFSGIIPTVYATALYDY
DPQFNDPQYLSIKKGDIIQVITQSKNGWWYGDLLRTKTKGLFPQSYVQVQDYGL
Download sequence
Identical sequences Q756W1
tr|Q756W1|Q756W1_ASHGO NP_984999.1.49492 33169.AGOS_AER140C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]