SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 335543.Sfum_1234 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335543.Sfum_1234
Domain Number 1 Region: 291-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.59e-53
Family Ribonuclease PH domain 1-like 0.0000252
Further Details:      
 
Domain Number 2 Region: 5-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.24e-47
Family Ribonuclease PH domain 1-like 0.0000296
Further Details:      
 
Domain Number 3 Region: 448-546
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.28e-25
Family Ribonuclease PH domain 2-like 0.00018
Further Details:      
 
Domain Number 4 Region: 144-226
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-25
Family Ribonuclease PH domain 2-like 0.0026
Further Details:      
 
Domain Number 5 Region: 553-637
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 6 Region: 609-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.06e-21
Family Cold shock DNA-binding domain-like 0.0004
Further Details:      
 
Domain Number 7 Region: 238-318
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.94e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 335543.Sfum_1234
Sequence length 699
Comment (Syntrophobacter fumaroxidans MPOB)
Sequence
MKHSVQVEVGGRPMVFEAGEIARQAGGSVLMRYGDTVVLIAATKEDRIREGIDFVPLMVD
YQEMSYAAGRIPGGFFRREIGRPSEKETLTSRLIDRPIRPLFPKKYCYETQVVATVLSVD
MENEPDVVALTGASTALHISPVPFQGPVAAVRVGRINGSFAINPSAKELLESDLNVVVAG
SRDAVVMVEGGADFVSEDDLVDAIDFGHKAILPILDAQDELQRRIAPVKEAPPEVVRNES
LVQAVRDAAAAEMRAVMTTPEKHPRRDRKKALKERIQAELVSDDPDRPKQIDNILEDLEK
EVVRRMMVEEGRRIDGRRFDEIRPINIQAGVLPRTHGSAVFTRGETQVLAVVTLGSSSDE
QKIEALAGETFKSFMLHYNFPAFSVGEVRPLRGPGRREIGHGALAERSVKAVLPRDGEFP
YTIRVVSEVLESNGSSSMATVCGSSLALMDAGVPITEPVGGIAMGLVKEGDKIIVLSDIL
GDEDHLGDMDFKVTGSERGITAIQMDVKIAGIDRGIMQRALEQARAGRIFILGKMKEVLS
APRPELSPYAPRVITIMINPEKIRDVIGPGGKVIRSIVAETGAKIDIEDSGKVVIMSPDG
AACDKAVERIRGLTQEPEVGQLYMSRIVRVTDFGAFAEILPNIEGLIHISQLEHRRVRKV
TDVVQEGDEVLVKVIEIDKDGRIRLSRKAALEKPEGGGQ
Download sequence
Identical sequences A0LHM4
gi|116748674|ref|YP_845361.1| 335543.Sfum_1234 WP_011698097.1.10770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]