SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 338966.Ppro_1203 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338966.Ppro_1203
Domain Number 1 Region: 9-282
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.23e-52
Family ROO N-terminal domain-like 0.000000948
Further Details:      
 
Domain Number 2 Region: 249-393
Classification Level Classification E-value
Superfamily Flavoproteins 2.25e-35
Family Flavodoxin-related 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 338966.Ppro_1203
Sequence length 405
Comment (Pelobacter propionicus DSM 2379)
Sequence
MGVPINKTITWVGKVDWELRTFHGEEYSTHRGSSYNSYLVRDEKTVLIDTVWAPFAKEFV
HNLQQEIDLKNIDYIIVNHGESDHSGALPELMRLIPDIPIYCTANAVKSLKGHYHQDWNF
HVVKSGDRLNIGTKELIFVEAPMLHWPDTMFCYLTDDNTLFSSDAFGQHYATERMFNDLV
DQPELFQECIKYYANILTPFSPLVDRKIKEFVGLNLPLDMICPSHGVVWRDNPLQIVTTY
LEWAANYHENQITIIYDSMWDGTRKMAEAIARGITGSDRDVVVKIFNASRSDKNDIITEV
FRSKAILVGSPTINRGILSAMAAILEEIRGLGFKNKKAAAFGAYGWSGESVKMLSERLKE
GGFLLVNDGLKLLWNPDEKGLAACLDFGGEIARAGRMQYAPTSGS
Download sequence
Identical sequences A1ANA4
WP_011735126.1.31684 gi|118579632|ref|YP_900882.1| 338966.Ppro_1203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]