SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 339671.Asuc_1128 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  339671.Asuc_1128
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily CAC2185-like 4.18e-89
Family CAC2185-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 339671.Asuc_1128
Sequence length 206
Comment (Actinobacillus succinogenes 130Z)
Sequence
MLTILRKISNRLFRPAINKRLRRRLKNHRMSVIAGNCNGALILHDLQQQFRSPFVNLYLE
PADFIRYLQNPRHYQQAELVFEQTDKPYPVAKLDDIRLYFVHYHCEREAREKWLSRSSRI
NWDNLFVMTTDRDGCTEQNIADFDALPYPNKVIFTHKAYPQFTSAYYIRGFENQSEVGDL
FEFSGWFGKKYYDQFDYVAWFNGNDG
Download sequence
Identical sequences A6VNE7
WP_012072871.1.63012 gi|152978800|ref|YP_001344429.1| 339671.Asuc_1128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]