SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 339671.Asuc_2061 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  339671.Asuc_2061
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-49
Family Ribonuclease PH domain 1-like 0.0000118
Further Details:      
 
Domain Number 2 Region: 295-467
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.49e-46
Family Ribonuclease PH domain 1-like 0.0000178
Further Details:      
 
Domain Number 3 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.03e-31
Family Ribonuclease PH domain 2-like 0.00088
Further Details:      
 
Domain Number 4 Region: 452-559
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.38e-28
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 553-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 
Domain Number 6 Region: 619-694
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2e-20
Family Cold shock DNA-binding domain-like 0.0000783
Further Details:      
 
Domain Number 7 Region: 238-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 8.37e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 339671.Asuc_2061
Sequence length 707
Comment (Actinobacillus succinogenes 130Z)
Sequence
MNPIVKQFKYGQHTVTLETGAIARQATAAVMASMDDTTVFVSVVAKKEVKEGQDFFPLTV
DYQERSYAAGKIPGGFFKREGRPSEGETLIARLIDRPIRPLFPEGFLNEIQIIATVVSVN
PQISPDLVAMIGASAALALSGVPFNGPIGAARVGFINDQFVLNPTMAEQKQSRLDLVVAG
TDKAVLMVESEADILTEEQMLAAVVFGHQQQQVVIEAIKELVKEAGKPRWDWVAPEPDTA
LINQVKVIAESRLGDAYRITEKQVRYEQIDAIKADVIAQITAENEEVSEGKIVDIFTALE
SQIVRGRIIAGEPRIDGRTVDTVRALDICTGVLPRTHGSAIFTRGETQALAVVTLGTERD
AQILDELTGERQDTFLFHYNFPPYSVGETGRVGSPKRREIGHGRLAKRGVAAVMPSISEF
PYVVRVVSEITESNGSSSMASVCGASLALMDAGVPVKSAVAGIAMGLVKEEDKFVVLSDI
LGDEDHLGDMDFKVAGTRTGVTALQMDIKIEGITPEIMQIALNQAKSARMHILGVMEQAI
AAPRAEISEYAPRIYTMKIDPKKIKDVIGKGGATIRTLTEETGTSIDIDDDGTVKIAAID
GNAVKEVMARIEEITAEVEAGAVYTGKVTRLADFGAFVAILGNKEGLVHISQIAEERVEK
VSDYLQVGQDVQVKVVEIDRQGRIRLTMKDIVSKAENADAQTDIVEE
Download sequence
Identical sequences A6VR10
339671.Asuc_2061 WP_012073783.1.63012 gi|152979713|ref|YP_001345342.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]