SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP0314A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP0314A
Domain Number 1 Region: 166-276
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.44e-27
Family Single strand DNA-binding domain, SSB 0.0036
Further Details:      
 
Domain Number 2 Region: 271-368
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.54e-18
Family Single strand DNA-binding domain, SSB 0.0063
Further Details:      
 
Domain Number 3 Region: 51-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000386
Family Single strand DNA-binding domain, SSB 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP0314A
Sequence length 467
Comment (Natronomonas pharaonis)
Sequence
MGAIEDIYEDLDADVSESEFREAVEAKVEQMGGLADEETAAMLIAHDLDGGEVETIADIE
PGLEEVKFLGKVASVGELRTFERDGEDDEDGHVLNLDVADESGTVRVALWDDDAVAADEE
VEPGQVFRIKGRPKDGYSGVEVSADRIEADEEAEIEVDLDGRTTADSLSMGQSDVTLRGV
VLDTDAVRTFDRDDGSEGRVSNLTLGDETGKIRVTLWDEQADRAEALEAGQSVEIVDGYV
REREGDLELHAGSRSDIDELDESVEFVPDATDIDSIAIDETVDIAGVVRSADPKRTFDRD
DGSEGQVRNVRLQDNTGDIRVALWGEKADLDVGPGDEVFCADVEIQDGWQDDLEASAGWQ
STVVVLDDDDPDRGGDSAGLDEFSGGSAAAHDGSDGSDPAADDEAASDAGDEPETVTGTV
VQPADPVILDNGDETIHVETDAEVHLGQEVTVRGRRDGERFVAEDVF
Download sequence
Identical sequences A0A1U7ETL5
gi|76800811|ref|YP_325819.1| WP_011321886.1.57290 348780.NP0314A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]