SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP0328A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP0328A
Domain Number 1 Region: 4-226,269-367,429-481
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.98e-107
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000614
Further Details:      
 
Domain Number 2 Region: 465-571
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.57e-33
Family Anticodon-binding domain of Class II aaRS 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP0328A
Sequence length 578
Comment (Natronomonas pharaonis)
Sequence
MSELETLTELAKRRGFFFSSNEAYGGTAGFYTYGPEGAALKRNLEDIWRDIFVRELGNME
LEAPTVMPEAVFEASGHLDGFDDMIIECPECGATHRADHLVEDEIEDIEDAEAYEPTEVA
ELIATHHIECPSCGESLAGESVEEFNLMFGTNIGPGSSAPGYLRPETAQGIFVEFPRLKE
YARNKLPFGVAQIGRAYRNEISPRRALVRVREFTQAELEHFIDPERDEPPIDRVADVELP
LYSVANQNAENGGVETYTVAEAVDSGIIESEWVAYYLGRSMDFYERIGIDMDRFRYRQHL
PGERAHYAADCWDAETELGGSWVEVTGFAYRSDYDLSKHGDYSKEEFTLFRQYDEPKTVE
RATVDPDMSYLGPEFGGAAGDIAAALESLAGRDRSAFDGDEVTVEVDGDEYTVPVERTGF
AVEEQTEAGEHITPHVVEPSFGVGRLVYSVLVHSHGTDTVDDEERTYLDLPAELAPTTVA
VFPLMTKDGLDDRAREVSETLREAGFEVAYDDTGNIGRRYRRQDEVGTPYCVTVDYETQE
DGTVTIRERDSTDQTRVPVEGLPAAIAELVDGATLAEL
Download sequence
Identical sequences A0A1U7ETL2
gi|76800818|ref|YP_325826.1| 348780.NP0328A WP_011321893.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]