SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP0564A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP0564A
Domain Number 1 Region: 47-284,317-410
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.16e-46
Family Tandem AAA-ATPase domain 0.00032
Further Details:      
 
Domain Number 2 Region: 545-705
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.09e-20
Family Achaeal helicase C-terminal domain 0.023
Further Details:      
 
Domain Number 3 Region: 426-518
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000435
Family RecQ helicase DNA-binding domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP0564A
Sequence length 803
Comment (Natronomonas pharaonis)
Sequence
MSLPPPASFVASRTEYEPGTPVEAVFPSFAEAFPFESFNRMQSAALPAIADRDDNVVVSA
PTASGKTALAEAAICRTLDAGGTALFLAPLRALTNEKESEWERFESLGYSVYVVTGERDL
DPRRAERADILVMTPEKADSATRKHDSPRYAFITDIDCCVIDEVHLLDSDRRGAVLEVTV
SRLRRLCDPRVVALSATMQNVDDVAAWLDAPPESTFEFGDDYRPVPLSATVETYAHGDNA
FADKYRRLYRALDLAEPHINEGGQALVFVASRQDTVRAAEKARDELAERDIDIGARGDYD
FHTDAAELENDTLRKSVVDGVGFHHAGLSKADKDRVEEWFKQGKIQLLFSTSTLAWGVNL
PARCVVIRDTKLHDPLEGEVDISPLDILQMLGRAGRPGYDDAGYAHIVCDGSDADKYRQL
LRDGKPIESRLAETLDSHLNAEIALGVVDDIDDVLSWLETTFYYARAQSAPGKYEAGDSL
RDRVSATLERLVDGGFVDQSGLNIEPTGLGRLTSQFYLQLNTAESFDALCQRAASNESPP
IDESTVLRAVADAAAFDSVSARRDEREAFEAVLGHEGDDLDDGNRKVLAILRAGMDGTTP
GELQSDAWVIRRNARRLLAALRAFCERFADPRDANLVRRIEARIEHGVSDDTVGLVAIEG
VGTGRAQTLAEAGIDSPAAVRAAGVDGLRKAGLSESVAERIHEQARDLPALDFDWKDIPD
RIRHGENTMGEVTIKNAGGGEPAGIRVTVNGVEMTQQTSYLGEATVPVGVFGGDAETLTY
EVEVAFPNLPLRPVVDSRTVDVA
Download sequence
Identical sequences WP_011322009.1.57290 gi|76800934|ref|YP_325942.1| 348780.NP0564A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]