SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP0588A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP0588A
Domain Number 1 Region: 13-279
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-40
Family Extended AAA-ATPase domain 0.00038
Further Details:      
 
Domain Number 2 Region: 288-372
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-20
Family Helicase DNA-binding domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP0588A
Sequence length 374
Comment (Natronomonas pharaonis)
Sequence
MADDDMLSWDESVFRDEGVLELDYLPEAFLHRDEQMETLKYALRPAVRGSRPLNVMARGP
PGTGKTTAVQKLFDELAGVGGVETVRVNCQVDSTRYAVFSRLFESLFEYEPPASGVSFNK
LFGQITNRLVEDDDVLVVALDDVNYLFYESEASDTLYSLLRAHESHSGAKIGVIVVSSDL
DLNVIEELDGRVQSVFRPEDVYFSAYGERAIADILSERVERGFREGAVSARVLDRVAEHT
ADSGGDLRVGIDLLRRAGLNAEFRGSTEVAVADVDTAYEKAKYIHLSRRLQGLSESEAAL
VRVLTDHDGERAGAVYEAFSEETELGYTRYSEIVNKLEQVGVVDAEYTNVDGRGRSRELS
LAYDADAVLERLEE
Download sequence
Identical sequences A0A1U7ETW8
gi|76800946|ref|YP_325954.1| 348780.NP0588A WP_011322021.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]