SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP0596A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP0596A
Domain Number 1 Region: 125-219,274-446
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-51
Family Extended AAA-ATPase domain 0.00093
Further Details:      
 
Domain Number 2 Region: 451-557
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.81e-30
Family Helicase DNA-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP0596A
Sequence length 571
Comment (Natronomonas pharaonis)
Sequence
MTNDDTASEPRTQDRLERGSGDTDEDSEDTVDIDTDTEGSDDVATPSQSSGSPVETGGFS
EDESDSERTDSVPTGSEHARNVDGFSGDIDLEDLDLAPDDETEEDGEADEASRGLFDDLL
EGEPIFENKEVLRPSYTPHKLPHREEQINNMATILVTALRGETPSNILIYGKTGTGKTAS
AKFVSEELETTSQKYEVPCEVQYINCEVTDTQYRVLAQLANKFIEKNEAYIESRLDELEA
LRDRAAEDPAALDDTEFDSVAAVEAEIDTLETDLEEFDPVPMTGWPTDRVYSTFFDAVDY
HERVVVIMLDEIDKLVEKSGDDTLYNLSRMNSELSNSRVSIMGISNDLKFTDFLDPRVKS
SLGEEEIVFPPYDATQLRDILQHRAEIAFKPDTLSDDVIPLCAAFAAQEHGDARRALDLL
RTAGELAERDRTETITEKHVRKAQEKIELDRVVEVVRTLPTQSKLVLYATILLEKNGVHN
INTGEVFNIYKRLCEEIDADVLTQRRVTDLISELDMLGIVNAVVVSKGRYGRTKEISLSV
PLDETEAVLLSDSRVGEVEDAQPFVQARFDN
Download sequence
Identical sequences A0A1U7ETY0
gi|76800950|ref|YP_325958.1| 348780.NP0596A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]