SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1142A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  348780.NP1142A
Domain Number - Region: 211-247
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00474
Family MarR-like transcriptional regulators 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1142A
Sequence length 250
Comment (Natronomonas pharaonis)
Sequence
MRSETELRPVQEVHVAPVGYEYDRIKRPALEYGADTLYLLRERERTELSYHDRLVTELTD
RGMTVRSREVDLDDMYDVLGEVTTIVHGHDGDIVRVNVSSGPKLSTVGAALACMATDASG
YHVHPETRAHPLDEQPRTEGMQFAEQLPSYPLETPTEDQVRVLDYIDRRDSETYTPKKSD
LIEFAEDEQLDFLTRSEPANDKAKFALLNNRILEPLSANGYVHIEPVGRTKQVSLTDTGE
NALRAFRHKL
Download sequence
Identical sequences A0A1U7EUK8
gi|76801223|ref|YP_326231.1| 348780.NP1142A WP_011322298.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]