SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1176A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP1176A
Domain Number 1 Region: 19-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000506
Family Z-DNA binding domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1176A
Sequence length 92
Comment (Natronomonas pharaonis)
Sequence
MSTTTEERSRQSESPMSDPEFRETLRELPPSAKLVAKVLEGASPMSQGQLAEKSLLPDRT
VRYALNRLEEEDLVDSRYSFNDARKQVYFLIN
Download sequence
Identical sequences A0A1U7EUP4
WP_011322315.1.57290 gi|76801240|ref|YP_326248.1| 348780.NP1176A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]