SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1238A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP1238A
Domain Number 1 Region: 15-190
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.86e-35
Family RNA methyltransferase FtsJ 0.0000735
Further Details:      
 
Domain Number 2 Region: 189-252
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.28e-16
Family TRAM domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1238A
Sequence length 252
Comment (Natronomonas pharaonis)
Sequence
MTRKDDYYNRAKQQGYRSRAAYKLKQLDEAADLINEGDTVVDLGAAPGGWLQVANELAGE
AGTVVGVDLQRIDPIEGVETVRGDMTEDATREKVRALVGEADVVISDMAPNMTGEYSLDH
ARSVHLARMAFETALDLLAPNGDLVAKVFEGPDTDDLRADIDREFEYVRTIHPDASRDSS
SELFMVAKGRLTAPVREGDTLEVEIDNLGDEGDGVAKVDGYTLFVSGAEPGDAPEVRVTD
VKPRFGFAETLE
Download sequence
Identical sequences Q3IT24
gi|76801271|ref|YP_326279.1| 348780.NP1238A WP_011322346.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]