SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1258A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP1258A
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3e-33
Family Cold shock DNA-binding domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1258A
Sequence length 97
Comment (Natronomonas pharaonis)
Sequence
MSDNEGRKNLRMPEGDEVFAVVTNMLGANRVKVRCMDGTERTARIPGRMQKRIWIREDDV
VLVEPWDWQDEKADVVWRYEKQEADQLREEGHITDSV
Download sequence
Identical sequences Q3IT14
gi|76801281|ref|YP_326289.1| WP_011322356.1.57290 348780.NP1258A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]