SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1298A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP1298A
Domain Number 1 Region: 43-107
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000428
Family TRAM domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1298A
Sequence length 158
Comment (Natronomonas pharaonis)
Sequence
MPDCPLADDCPSFSERIEGMGCQHYGDRGGAEWCSHYSQPINDLKQQPVQVGEEVVVDVG
DIHESGAGVGRTEDGFIVMVDGVLPEARAKVRITEVRSNHARADEVERLPLEEDEDGSSE
PDTTDDSDPGAEEADDRSDRERALDREELGSRENFWGN
Download sequence
Identical sequences A0A1U7EUU4
348780.NP1298A WP_011322375.1.57290 gi|76801300|ref|YP_326308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]