SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1450A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP1450A
Domain Number 1 Region: 348-406
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000172
Family Iron-dependent repressor protein 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1450A
Sequence length 434
Comment (Natronomonas pharaonis)
Sequence
MGRSRYVVLVLAVAAFAAVAAGAATAAADSPGSAAAETESADFADIDEDGFEADRTRFLI
TTYGNGSADWTFRYEQRLETDDDIENFGGFAARFTETETDAYTEFQARADSLAASGEEAT
DRRMAASRFDRDAYIEERPPAGTEFGIVEMTFRWNGFAAIEDDSVTVGDVFVGGLYVDPD
NELQFEAGPGLAFESVDPEPDSMAGGTLAESETVTWVGEQEFTDRRPRLVHTEQQADRPP
AEQNGDETPAPANNGSWLVPLAALLVVVLAGGTAIAYQTGTFPRRTESGGDGTAESDAGG
VSTTETVDDGAAAGGTAVDDGAPDRDAGGSADTVASGEPAVTDEMLQPDEKRVVDLLERN
GGRMKQVAIVDETDWSKSKVSMLLSEMEEEGTVSKLRVGRENIVSLAGHEPEAAGSPFDD
GEDDTDGDGNSDGT
Download sequence
Identical sequences A0A1U7EUY3
gi|76801376|ref|YP_326384.1| WP_011322451.1.57290 348780.NP1450A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]