SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1496A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP1496A
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000207
Family Iron-dependent repressor protein 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1496A
Sequence length 145
Comment (Natronomonas pharaonis)
Sequence
MNTQAQYLKAIYLVQEREDGPASTGAIADMLEVSPASANEMIGKLEDQGLADHEKYKGVS
LTDEGIVQAREALETYCIIERFLWEVLEVEDFRTEARQLEAVIDETVAERLDTIIDRNDR
CPDCFDAEADACELLDIELETEPAD
Download sequence
Identical sequences A0A1U7EV08
WP_011322473.1.57290 gi|76801398|ref|YP_326406.1| 348780.NP1496A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]