SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1522A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP1522A
Domain Number 1 Region: 19-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000025
Family RPO3F domain-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1522A
Sequence length 111
Comment (Natronomonas pharaonis)
Sequence
MSATDTKAVESDGWEAVAELPPSAKLVAKVLEYNDRLTQSQLAEETMLPPRTVRYGLNRL
EEVDAVDSRFSFTDARKRVYTLAVEDEAKQDGTRGTKRDGTRSGSVLPADD
Download sequence
Identical sequences A0A1U7EV10
gi|76801411|ref|YP_326419.1| 348780.NP1522A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]