SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1562A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP1562A
Domain Number 1 Region: 24-101
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000865
Family CodY HTH domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1562A
Sequence length 125
Comment (Natronomonas pharaonis)
Sequence
MSAELHRNDPTRTTQRDTATPGDCEAVLAALEDPDCRALLEATTDEALTAQELTERCDIP
RSTTYRKVEQLTDAGLLEERVRISTNGKHASEYRRTFDDVTISLCESEGVTVGISRATAS
PATGD
Download sequence
Identical sequences A0A1U7EV32
348780.NP1562A WP_011322506.1.57290 gi|76801431|ref|YP_326439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]