SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1628A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP1628A
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000988
Family MarR-like transcriptional regulators 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1628A
Sequence length 257
Comment (Natronomonas pharaonis)
Sequence
MVDVLDNKRSATKFRVLVEIADRQPAVNQGEIADAVGVTSQAVSEYIRELVDEGFVEKEA
RSRYRVTKEGVDWLFQQAADVSRFAEHVTEDVLGSMQEDAAFAADDIAAGETVSLSISDG
LLYATPGDSGPATGVATTDAETGDVVGVTGFAGIIDLDPGSVTVFQVPPIRSGDPSGSPE
LADTAADADVVAAAGVEGVAALRDVDADPDVTFAAGEVAADAAGRGLDVVVVATTDLAGR
VTDALRDAGIAYEVDDI
Download sequence
Identical sequences A0A1U7EV65
WP_011322539.1.57290 gi|76801464|ref|YP_326472.1| 348780.NP1628A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]