SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1692A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP1692A
Domain Number 1 Region: 118-439
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.64e-84
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000238
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily tRNA-binding arm 3.71e-28
Family Seryl-tRNA synthetase (SerRS) 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1692A
Sequence length 456
Comment (Natronomonas pharaonis)
Sequence
MLSRQFVRENPEEVRRALDTKGVDVDLDRILDIDEEWRELKAEGDDLRRQRNEVSSEIGK
LKRDGEEEAAAEAIERSQELKEEIEAVEDRADELESELEAALLRLPNVPHPDAPVGDDES
DNVEIDRWGFDDRRSLPDEVVPHYDLGEELDILDFERGAKVSGGGFYFAKGEGARLEHAL
VQFMLDVHRDEHGYTDVFPPLPVNSASMRGTGQFPKFVEDAYRIGGDNDDPYDDDDLWLL
PTAEVPVTNMYRDEILLDDDLPLKQQAYSPNFRREAGEHGTETRGIVRVHQFNKVEMVNF
VRPENSYDRLEGLLGEATDVLERLGLPYRVLEMCTGDMGFTQAKKYDVEVWAPGDDMEDG
PDVGGRWLEVSSVSNFEDFQARRAHIQYRPEQHESAEYIHTLNASGLAVPRVVVAILEYY
QNDDGTVDVPEPLQPYMGGTDVIDGQDPVGESALGE
Download sequence
Identical sequences A0A1U7EV99
gi|76801495|ref|YP_326503.1| WP_011322570.1.57290 348780.NP1692A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]