SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1842A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP1842A
Domain Number 1 Region: 21-85
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000467
Family Penicillinase repressor 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1842A
Sequence length 199
Comment (Natronomonas pharaonis)
Sequence
MALPAWIEDRTEFDLNKKLTQRHVVETMLEAERPFFSAEQIRARVQPEVSKETVRNRLDE
LHEIDVVAAETYPESITLYYINHPESEWPLSPEGAEALSHSTPLETLSLADFVRLRNPAG
IRTLVLAGFQLSLVLFVVGVVAAVAMVDPAVQSDNGFWAAAGNLFVLCLFLLLAERIARK
VRTDGARSLLPTPEQFVSK
Download sequence
Identical sequences A0A1U7EVI3
gi|76801569|ref|YP_326577.1| 348780.NP1842A WP_011322644.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]