SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP2114A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP2114A
Domain Number 1 Region: 129-205
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000361
Family Hypothetical protein PH1932 0.057
Further Details:      
 
Domain Number 2 Region: 63-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000662
Family FaeA-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP2114A
Sequence length 214
Comment (Natronomonas pharaonis)
Sequence
MDRQHVAVLVAVCMALALVPAGVAAAEEPAEAVAAATGPTVDATVTDRYRAGASAGLSRV
DTDGVLEQPTRATIYEAIDESPGIDLAGLAAAADVTKSTARYHVDVLRDAGLVAGVEVAG
ALRFAPAELDAEVAGVLETDAPGTVLTAVADHEPASVRTLAEATDRAPSTVSHHLSELEA
RGLVERERRGEAVLTSLAPPARDALGAPPATADD
Download sequence
Identical sequences A0A1U7EVR9
WP_011322776.1.57290 gi|76801701|ref|YP_326709.1| 348780.NP2114A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]