SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP3002A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP3002A
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.4e-20
Family F93-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP3002A
Sequence length 92
Comment (Natronomonas pharaonis)
Sequence
MYDLTGFQRDLLYVIAGREEPHGLAIKEELEDYYEKEIHHGRLYPNLDTLVEKGLVEKGQ
RDRRTNFYTLTRRGRREIEARRDWEDEYVDIE
Download sequence
Identical sequences A0A1U7EWU9
WP_011323216.1.57290 gi|76802142|ref|YP_327150.1| 348780.NP3002A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]