SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP3418A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP3418A
Domain Number 1 Region: 19-126
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.05e-33
Family SSO2064-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP3418A
Sequence length 147
Comment (Natronomonas pharaonis)
Sequence
MSDRADRPLDAESPLTLPGFFAALDDGELFGGVCTDCGAVLFPPRPTCYNCGGTNVSAEP
QPKTGTVYTYTAVHSPPPQLDDDAPYTIAVVELDGGGRLLGRVDAPYEAVEIGDEVRLRV
REPTDDERALALEYEREWPMHVFDLDG
Download sequence
Identical sequences A0A1U7EXA0
gi|76802347|ref|YP_327355.1| 348780.NP3418A WP_011323420.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]