SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP3652A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP3652A
Domain Number 1 Region: 26-94
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000291
Family SSO2064-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP3652A
Sequence length 120
Comment (Natronomonas pharaonis)
Sequence
MTMEAYRYPDGSITYPGHPVGPNGDEPVGTVDLSDHTAEVLTWTTSHATPVGVREPNHLA
IVEFRVDGQAVRALGQLTTGDVAIGDEVRPVYHEELRDPEAGIRDPESQSWDGYRFEPVE
Download sequence
Identical sequences A0A1U7EXL1
WP_011323535.1.57290 gi|76802462|ref|YP_327470.1| 348780.NP3652A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]