SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP3888A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP3888A
Domain Number 1 Region: 14-226
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.11e-45
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0000898
Further Details:      
 
Domain Number 2 Region: 284-609
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-36
Family Extended AAA-ATPase domain 0.0039
Further Details:      
 
Weak hits

Sequence:  348780.NP3888A
Domain Number - Region: 622-673
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000403
Family Heat-inducible transcription repressor HrcA, N-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP3888A
Sequence length 676
Comment (Natronomonas pharaonis)
Sequence
MSIMQETIEELVQFFRDYYPDEIGQLAMRFPRDQKSLYVDFDDVYRFDPDLADDLREQPE
RMLEAFEEALSHYDLPVDVDIGGAHVRIYNLPTTLDVEQVSRHSNIGTLLDIRGQVQKVS
AVKPRIQTAVFECQRCSTRTEIPQTGEQLQEPHECSGCERQGPFVLAEKSSDWVDHQYAR
IQQPPERTKGGEGETIDVHLEDDLIREFEAGDRITLTGMLDIETPDRNQSRAFDTTVDAQ
AVIREESDYEDIDVKTYRDEITAIASGEEGDPYELLIDSINPEHKGDEDIKLAIALQMFG
GWSRGGRVRGDSHILLLGDPGCGKSTFLQAVDDLAPRSTYASGKGATAAGITAAAVADDF
GESEWGLEAGALVLADGGIACLDEIDKVPKKAVSSMHDALESQRVRVNKAGINATLNSRT
ALLAAGNPSEGRFDPYQPRAQQIDLGPTLMSRFDLMFMVSDSPDVDSDREVVEHMIRSRR
AAAKQELGEELTEKEQRSIEPAIPKRILRAYIAYAKNEVTPYLPQGNSEARDYLQQEFLK
LRLANEDDESSPVPVTFRQEEAIERLAEASARVRLDDEVTKGDVDRALGLVRKSMEQVGI
DPETGEFDADVVETSQSKSQRTRRKRVLAIIEDKQGTTVEEVAEIIDETEKRVRNDVQSL
KNRGQVYELDGEVRPT
Download sequence
Identical sequences A0A1U7EXX0
gi|76802579|ref|YP_327587.1| 348780.NP3888A WP_011323652.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]