SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP3896A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP3896A
Domain Number 1 Region: 18-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000114
Family CAP C-terminal domain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP3896A
Sequence length 118
Comment (Natronomonas pharaonis)
Sequence
MRKQGDWMANWDDRFLEFAYDHGGATPKRIADNEHVHVSRQYVAKRLRELSDHGLLNKIG
RGSYTITKKGKYYLAGAYDAEKDEFLEYELRNYEWLILESEDKIEDFRSWFNDRSSAP
Download sequence
Identical sequences A0A1U7EXW1
348780.NP3896A gi|76802583|ref|YP_327591.1| WP_011323656.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]