SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP4106A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP4106A
Domain Number 1 Region: 7-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.16e-22
Family Transcription factor E/IIe-alpha, N-terminal domain 0.002
Further Details:      
 
Weak hits

Sequence:  348780.NP4106A
Domain Number - Region: 116-147
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.000732
Family RBP12 subunit of RNA polymerase II 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP4106A
Sequence length 175
Comment (Natronomonas pharaonis)
Sequence
MAFEDLLNDPVIQKYLHELVGPTGMPVAAAPPDGEVTDEELAEELGLELNDVRRALFILY
ENDLASYRRLRDEDSGWLTYLWTFQYENIPEQLEEEMHRLLEALENRRQYESENEFYLCG
ECQLRFEFDEAMEFGFECPECGGRLESMENDRLVNAMEQHIEALRDELHVETAEA
Download sequence
Identical sequences Q3IP08
WP_011323760.1.57290 348780.NP4106A gi|76802687|ref|YP_330782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]