SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP4138A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP4138A
Domain Number 1 Region: 19-124,152-280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.05e-58
Family ABC transporter ATPase domain-like 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP4138A
Sequence length 287
Comment (Natronomonas pharaonis)
Sequence
MSDDATVGTETMTTEGESILEIRSLDAGYGDLQILSDVDLDVDDGEYVTIVGPNGAGKST
VMKSVFGLTTHMGGTVTFDDEEIQDHSPERIIRTGIGFVPQTDNVFGGLTVRENLEMGAY
ILEATPADLAEQYPRTAGQLSQSSLESLCRWVPLHRVLGDSVPQDRIDTIYDRFPILEER
KHQKAGTLSGGQRQMVAMGRALMLDPDLLLLDEPSAGLAPDLVEDMFDRIDRINDAGTAI
LMVEQNAKEALRRCDRGYVLVDGQNRYMDSGDALLADDQVRQDFLGG
Download sequence
Identical sequences A0A1U7EY64
gi|76802703|ref|YP_330798.1| 348780.NP4138A WP_011323776.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]