SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP4378A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP4378A
Domain Number 1 Region: 75-243
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.19e-48
Family Biotin holoenzyme synthetase 0.00013
Further Details:      
 
Domain Number 2 Region: 2-57
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000488
Family Biotin repressor-like 0.046
Further Details:      
 
Domain Number 3 Region: 258-300
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.0000197
Family Biotin repressor (BirA) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP4378A
Sequence length 306
Comment (Natronomonas pharaonis)
Sequence
MQQTRRQVLDALADGPVAGPELATRLDISRAAVWKHVEALREDGFDIESRNNGYVLVDVP
EFGGAAVEHQLDASVDIEYHDRIASTNDRARELAADGAEGVCVLADEQTGARGRLDRPWE
SPAGGVWLSLVYRPDLPPSQVPVYTLAAAVAATAALREVGVSAEIKWPNDILVDGEKLVG
ILTEMEGEADRVSWVVVGIGINANIDAASVPDHATTVKEQVGDIDRGALTASIIDRLEAL
RNAPEDVPEAWRELSTTIGQIVRVETPGETVTGEAVGIEFPGTLVVETDDGKRRIAAGDC
EHLRPA
Download sequence
Identical sequences A0A1U7EYF7
348780.NP4378A WP_011323896.1.57290 gi|76802823|ref|YP_330918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]