SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP4444A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP4444A
Domain Number 1 Region: 66-127
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000348
Family F93-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 348780.NP4444A
Sequence length 163
Comment (Natronomonas pharaonis)
Sequence
MSSQGNVEPTLERLVTELGDGDATRDDADPAARTEAVVTEASETLFEGGTLHVDDGLIKQ
SLPELLLLLVGLRSTDTHGKGIMEDLSRFFGAQLSPGTVYPMLHDLEADDLLEMRELVQT
KEYTIDDTEAVRGEIQAAMQQHLALGLVFSRALDEIDVDEMDD
Download sequence
Identical sequences A0A1U7EYI5
WP_011323928.1.57290 gi|76802855|ref|YP_330950.1| 348780.NP4444A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]