SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP4498A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  348780.NP4498A
Domain Number - Region: 185-246
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000109
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.038
Further Details:      
 
Domain Number - Region: 11-131
Classification Level Classification E-value
Superfamily Xylose isomerase-like 0.0179
Family IolI-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP4498A
Sequence length 352
Comment (Natronomonas pharaonis)
Sequence
MSETAGLDRLDRAVINAYQGGFPVVESPFEPAAEALADHGVDVTATELLKRVQTLDEEGV
LTRFGALINAAEIGGAATLVAMHAPEDRFEAVAEQVNSHREVAHNYRREHPHLNMWFVVS
VADADAVERVLADIEDETGQETYNLPKQQEFRVEAKFLVDGPIPDGDVDLSDLGPDASPT
DRGTLTPEERDLVVEIQDGLPVTETPYADVAAELGVDTDWVLRTIQRFNESGKIRRVGVI
PNHYALGYTENGMTVWSVPDEKLDEVGPEVAGLDFVTHCYERPRHEGVWPYNFFAMTHGR
SEDESKRRIQQVKSTMEEYWDVGDDDWDSLFSTEILKKTGIRLDERATANTE
Download sequence
Identical sequences A0A1U7EYN6
WP_011323955.1.57290 348780.NP4498A gi|76802882|ref|YP_330977.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]