SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP4552A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP4552A
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3e-17
Family Cold shock DNA-binding domain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 348780.NP4552A
Sequence length 64
Comment (Natronomonas pharaonis)
Sequence
MAKGEVDFFNDTGGYGFIDTDESDEDVFFHMEDIGGPDLEEGQEVEFDIEQADKGPRAKN
LTRL
Download sequence
Identical sequences A0A1U7EYN2
gi|76802909|ref|YP_331004.1| WP_011323982.1.57290 348780.NP4552A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]