SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP4684A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP4684A
Domain Number 1 Region: 55-109
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000294
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP4684A
Sequence length 142
Comment (Natronomonas pharaonis)
Sequence
MTENTLKITFQQAREHRQAARERLRQAEAGDTSKPIEQDVRFILNFEEFDDIARLMRTAN
LELIEAIVSEEPASIRQLAETVDRDYREVHRNLTELESLGVIEFEDDGSRKKPLLRDGAE
NIDFSIRFPRSPDRGEVPGTSA
Download sequence
Identical sequences A0A1U7EYU2
348780.NP4684A WP_011324047.1.57290 gi|76802974|ref|YP_331069.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]