SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP5044A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP5044A
Domain Number 1 Region: 1-324
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.36e-69
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000336
Further Details:      
 
Domain Number 2 Region: 336-419
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 9e-19
Family Anticodon-binding domain of Class II aaRS 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP5044A
Sequence length 432
Comment (Natronomonas pharaonis)
Sequence
MYDGLKGFREFYPGEMSARREVTDTIETRARRYGFREVGTPALERTQLYVDKSGEEIVEE
LYAFEDKGGREVSLTPELTPTVARMVVAKQQALAKPVKWFSTRPFWRYEQVQQGRFREFY
QTNIDIFGSERPEADAEVLATAADALTDLGLDGADFEFRVSHRDILGGLLAAMDSDVDTT
DAIRAVDKREKIDDEEYRSLLVGAGLTHEEADTFDSLLRTDDLSELVEFAGTDRVEAAVE
NLQAVLDAAADFGVREFCSVSLETARGLDYYTGVVFECFDTSGEVSRSVFGGGRYDDLIE
SFGGQPTPAVGVGIGHETLSLLCQRAGVWPAEELSTDYYVLTVGDTRDVALDVARELRAL
GHVVETDLSDRGFGDQLSYADGINAETVVVVGEQDLEDDAVTLKDMASGDQTQVPLAAFP
PEEGRPTYDDYA
Download sequence
Identical sequences Q3IMP5
gi|76803150|ref|YP_331245.1| WP_011324223.1.57290 348780.NP5044A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]