SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP5312A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP5312A
Domain Number 1 Region: 193-345
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.7e-16
Family MoCo biosynthesis proteins 0.038
Further Details:      
 
Domain Number 2 Region: 514-560
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000445
Family ComEA-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP5312A
Sequence length 572
Comment (Natronomonas pharaonis)
Sequence
MQDPADLDVTIVDGYVDEPAHFGVPPYISTYPRFAAGAAVDAGVDPDSITYHTIDELRES
RRLWEDVADADLFVYVGGMTVPGKYVGGTPAEPDEVRKLAWTAEGVSVMGGPVRFGVGEA
NEGATETKRQNLDYDFLALADIEAAVYDLLHGGLEGFEDRYRDNEELDRWARKGAFIVEQ
HPDHPDYLICELETSRGCPYRCSFCTEPMYGDPTFRTPDSVVSEVGGLADHGVRHFRLGR
QADILAYGGDGEAPNPDALRELYGGIRDVVPDLGTLHLDNMNPVTITDYPEKSREGIRVI
AEHNTPGDTAAFGLESADPVVREKNNLLVSAEECLEAVRIVNEAGGWRPGEAPGSGPSVD
ANADRLPKLLPGINLVHGLEGERAETFEHNKQFLQDVYDEGLMLRRINIRQVMAFEGTEM
AETGADIAHDHKQQFKTYKQAVREEIDNPMLQRVAPPGTVLPNVYLEYHEDGRTFGRQLG
TYALLVALPGERELGRTVDVAVTDHGYRSVSGVPYPLDINAASMDELRALPGIGKQRAGN
LFVDRPHETVPNLDDGPDLGTFCVTGGSGSAD
Download sequence
Identical sequences A0A1U7EZK9
gi|76803283|ref|YP_331378.1| 348780.NP5312A WP_011324356.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]