SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP6056A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP6056A
Domain Number 1 Region: 42-122
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.06e-19
Family ArsR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP6056A
Sequence length 133
Comment (Natronomonas pharaonis)
Sequence
MAQTTERLQRYLSDELGECCSEDVEQRLNELETLGDALATEQIASELDVLSALANETRYT
IIRVLVAAEEELCVCELNAVVDVTESGLSHALSQLVDADLVDGRKDGRWKKYRATNRAVA
LVTLLEGSVSTDA
Download sequence
Identical sequences Q3IM54
gi|76803392|ref|YP_327661.1| gi|76803392|ref|YP_327661.1|NC_007427 WP_011324413.1.57290 348780.NP6056A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]