SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP6208A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP6208A
Domain Number 1 Region: 77-358
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.17e-39
Family Extended AAA-ATPase domain 0.0069
Further Details:      
 
Domain Number 2 Region: 363-470
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000517
Family Helicase DNA-binding domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 348780.NP6208A
Sequence length 489
Comment (Natronomonas pharaonis)
Sequence
MGTDDSDASRPESRTPEDETTQADLSSSATSSNVPADVDHSTEAADGSPDAGSRSDESSS
QSIEDMLLEFDEQDGLIRDRSLLDPNYVVDEDRIVGRDDQLQEVTKMLRVTLGDNRPPNL
FLYGPSGTGKSLITKAVCNNINRICETRDIDFGTIEVNCQDLDTLGVAVYELATQAAEQA
GVAVQVPKHGVATKEKWDELFRIVNENFDSVVFVLDELDMLVGRRDKQEPAFSRLLYQLS
RAEATNDLRAYLSVVAISNDTKMMESVGSRALSSFTPEDVHFDDYDANQLQTILRHRQDA
FHDGVVDDDVIPLAAAFAAQTHGDARKAIDLMRVAGELAEREGSTRVREEHVRQAQEKVE
KNRVLEVVRGISTQKKLCLYATAAVAAQTDGGTARSTTGYRVYQFLTDSINADQYHQETY
VNKMKELTTYSLVDFERRSHGPSSGMFLEFQFGERPETILETLREDSRIEMVTSEEVQSV
VQAQIRKQT
Download sequence
Identical sequences Q3ILY5
gi|76803461|ref|YP_327730.1|NC_007427 348780.NP6208A gi|76803461|ref|YP_327730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]