SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349106.PsycPRwf_1726 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349106.PsycPRwf_1726
Domain Number 1 Region: 29-233
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.78e-27
Family Bacterial lipase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349106.PsycPRwf_1726
Sequence length 249
Comment (Psychrobacter PRwf-1)
Sequence
MLKLPLPNIVPLKKPDKPHKLSHKLMTHGDSERPFVVLIHGLHQKDWIMTPLAKQLQNRG
FATHQHNYHSLRERIDQHSKRLNQWLTEHHNPAIAIHLVGHSLGGLVIRDFVARYPHWKI
GRCVTLGTPHNGSTTAKYMSTLAAPLVGHSFKNALDGQSAPWPKSISLGVIAGDAPYGLG
QLVLNYHNQKVNLSQPQSAHDGTVYVFETQLNEATDHIIMPVSHTGMLINPKVAEQTAYF
LDHGYFKRR
Download sequence
Identical sequences A5WG75
gi|148653523|ref|YP_001280616.1| WP_011960943.1.63326 349106.PsycPRwf_1726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]