SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349307.Mthe_0972 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349307.Mthe_0972
Domain Number 1 Region: 89-393
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 1.07e-49
Family TM0189-like 0.029
Further Details:      
 
Domain Number 2 Region: 28-88
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000432
Family Type I dockerin domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349307.Mthe_0972
Sequence length 429
Comment (Methanosaeta thermophila PT)
Sequence
MGTAKSISALIVISCFIITQASAGNFVLHIFGNANMDDRIDENDLEFIRMVIQGEKSATE
LCDADHNGVVDASDITQVERIINGTATEITVIDSDGNVVTLPQPLERLVIYNHQCAEVLQ
LMGVDDRVVGVRDTFAEQRNRFPRLSQVTSIGSGGEPNIEAILKVKPQVVLAYTFYPVED
ALDAKLPPDVKVLRLDCECSGIGPDAMREKITMMGYIFGTQDRAEKYLKWHDAIVSQVEE
RVKTIPEDKRVRVYLESTPEGSNPQTSRTAIGSGHAANKLIEMAGGVNIAVGHLPKYLDT
PTEYGEIETEWVISQNPDVIVGRAMGKGIRPYENVNSSLLQSYDREIRNLPGFDRVKAVQ
DGRVYIITNDYAVTPNYPSALLALAKWFYPELFQDVDPVAAHQEYVNMMGLDFDVRTRGA
FTFHAGNSS
Download sequence
Identical sequences A0B7T4
gi|116754280|ref|YP_843398.1| 349307.Mthe_0972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]