SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI35041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI35041
Domain Number 1 Region: 113-206
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.56e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI35041
Sequence length 208
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
METTDNAANLEHPTFEKLSAQAASRGNKSEYRRIRCPAHRYTPLRENWEQLLTPLVEYLK
LQVRFNTRTRSVEIKTSRHTLDTSSLQKGADFISAFMLGFEPQDAVALLRLDDLFVESFK
VTDVKILRGDHLSRAIGRVAGQDGKTRFAIENATRTRVVIADQRIHLLGSYGNIKLARNA
ICDLILGAPPGKVYNNMRNVAKRMNERY
Download sequence
Identical sequences B8C5R0
35128.JGI35041 jgi|Thaps3|35041|e_gw1.6.446.1 XP_002291058.1.2071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]