SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351627.Csac_0415 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351627.Csac_0415
Domain Number 1 Region: 150-423
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.05e-60
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000311
Further Details:      
 
Weak hits

Sequence:  351627.Csac_0415
Domain Number - Region: 66-160
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0022
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 351627.Csac_0415
Sequence length 425
Comment (Caldicellulosiruptor saccharolyticus DSM 8903)
Sequence
MPPKSNGNESVKKGVISLTYVALAFIIILDILLGIIMPTGNLKLYSIVVATITFILTLAI
TAFMIRYEMNKMITKLENTLEVIKNGDYSKLILSKEFGNIQRVASSVNIVLSDIKLLIEE
FFNLSNAIVGASKKVTKTSEDAAAAIEEIAKTVEEIAKGASQQAEEAQHGVLLVNNLSEQ
LNAVSESYNAVIEETNKIETLNKDGIEKMNDLREKSEVALTTAEKVIETIMTFVERIKTI
SNFVEVINTIAEQTNLLALNAAIEAARAGEAGKGFAVVADEVRKLADQSKKAADEINSIV
DVILSETENTIKIIDEIKAAALGQRDAVIESQHSFGKISDEITAIVEKTQIVKEALNRME
EARNAVIRAIESISSVSQETAAASQEVAATVENQLNSINEMKYSAQSLQKLVDELDKKLK
KYKIR
Download sequence
Identical sequences A4XGL9
gi|146295474|ref|YP_001179245.1| WP_011916008.1.85531 351627.Csac_0415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]