SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 358681.BBR47_42950 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  358681.BBR47_42950
Domain Number 1 Region: 876-977
Classification Level Classification E-value
Superfamily Collagen-binding domain 8.24e-24
Family Collagen-binding domain 0.00044
Further Details:      
 
Domain Number 2 Region: 992-1093
Classification Level Classification E-value
Superfamily Collagen-binding domain 2.48e-22
Family Collagen-binding domain 0.00055
Further Details:      
 
Domain Number 3 Region: 784-867
Classification Level Classification E-value
Superfamily PKD domain 4.71e-21
Family PKD domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 358681.BBR47_42950
Sequence length 1105
Comment (Brevibacillus brevis NBRC 100599)
Sequence
MKKKRHTVHTSRMMAGVLLSTSFLLGTVGTPAQALAVKDYSSAIGRDAHQNVPPSGKYVE
GRLDPVTSFQHQSSDKAEEYPHPVEPSRRVEEQESSNEQQRSIKANAEKYAMADLNKLSY
DELVNILVTVSWEQIPELFDFTPDSYAFYNDRQRVQAIIDALQVRGTQYSSSDSKGIDTL
VEVLRSGYYLGYYHQELSYLNQRSEHEKVFPALQAIADNPNFKLGTDVQNEVVGAFGGLI
GNTFVSASLVEKAAPIIRQYEEQMDTFITQRSAGDAVFRIMSQFSYILMWKVDEPTKKQE
FYGKIDTYLNELGKLALHGDTDEAKEWVLDNGFYHSAHLGEYHSNPNKGNEVLTEALELY
PYVGLQYMQVAKLIQTVYGGKDAKGRDIQFNKIREDAMEKYLPKEYTFDDGSIVMKTGGD
VTEEKVKRLYWAAKEVKAQFHRMAGRDEPMEKGNPDDILTMVLYNSPSEYKMNNPLFGYE
TNNGGMYIEGKGTFFTYERTPQQSTYTLEELFRHEFTHYLQGRYAIPGLWNEGPIYRDER
LSWFEEGGAELFAGSTRTTGVLPRKSMVNNLIRFGQNNWYTASQTLHARYGTWDFYTYSY
ALQYHMMKEDWNKLDDIMDYIEANNVDGYDQFIRTLSNDSELNRDYHRTMESLVDSYPDL
TVPLVSDDYLVTPAPKASAEIYQEIEDVAGLQNVSTNRHHSEFFQTFTLTGTYTGTQAQG
EKQDWETMSRMTDEFLTTLTSHPWNGYKTVTAYFTNYRVNASNQFEYDVTFHGVLPEQGD
GENKPPVIVMNGPSKAAVNEEVAFSSNGSSDPDGSIVSYLWEFGDGTSSSDANPTHVYEN
QGEYTVKLRVTDDKGAVTAKSMTITIEEQGGEIGEKEQEPNNSFSEANPLKSNVELSGQT
SKQDDKDIFALKVLGNGTVKINVTSEHDTGLNWVVHHEDDLNNYLAYPKTSGKTLSGEFE
ATPGTYYLSVYNFNGETIPYKVTAEWPEENTEPTEVEPNNSFDDANTLQLGKEISGQTDR
TDDKDTYMIQVEEEGVIQVTVSSEKDEGLNWVVFHEDDLKTYFAYPKTTGKKLTGEFEAK
PGKYYLLVYNTNNTKIPYKAIVNAE
Download sequence
Identical sequences C0ZHZ8
gi|226313880|ref|YP_002773776.1| 358681.BBR47_42950 WP_015892536.1.45054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]