SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 358681.BBR47_52450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  358681.BBR47_52450
Domain Number - Region: 105-206
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000497
Family Collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 358681.BBR47_52450
Sequence length 226
Comment (Brevibacillus brevis NBRC 100599)
Sequence
MRTPTIRRVLKIDNNSHRSINVDLILAYSSNYYKKLHNIYLQSVYKMVKINSTYYHSFWR
DLFVKKVVASLLSLSLVLSASVSALAAEPAKSLKAPQKAASANDPYEPNDDPAFAPYINS
NTSYTAAIDHNRDADFFNFYAKPGDFTLAFSRLSASKHTFNIFVRKQGETKGETIKSQFG
IKGNTTLSVNIPEEGRYYIYIVSSDAAFDTTPINPMPYTFKAFFNQ
Download sequence
Identical sequences C0Z6M3
gi|226314830|ref|YP_002774726.1| WP_015893472.1.45054 358681.BBR47_52450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]