SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 358681.BBR47_52880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  358681.BBR47_52880
Domain Number 1 Region: 33-140
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000706
Family Collagen-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 358681.BBR47_52880
Sequence length 154
Comment (Brevibacillus brevis NBRC 100599)
Sequence
MKKKLLVGLSSLVLSLTVASSVFAASYWETETNQQSNNTWSQRDANGFVLGIGDVAQGYI
WDIDDEDYVAFYPKTSGTRTIRLNVPSNMDLKFEIWDAARNKVLDESISNKNGVGGAESV
TMYFSAQKYYILIDRVSKSGAEGNTTNGYALSIQ
Download sequence
Identical sequences C0Z6R6
WP_015893514.1.45054 WP_015893514.1.78400 gi|226314873|ref|YP_002774769.1| 358681.BBR47_52880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]