SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 358681.BBR47_54060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  358681.BBR47_54060
Domain Number 1 Region: 35-306
Classification Level Classification E-value
Superfamily Subtilisin-like 9.03e-88
Family Subtilases 0.00000707
Further Details:      
 
Domain Number 2 Region: 427-543
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000654
Family Collagen-binding domain 0.0035
Further Details:      
 
Domain Number 3 Region: 554-653
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000126
Family Collagen-binding domain 0.0045
Further Details:      
 
Weak hits

Sequence:  358681.BBR47_54060
Domain Number - Region: 333-410
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0623
Family YxiM N-terminal domain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 358681.BBR47_54060
Sequence length 852
Comment (Brevibacillus brevis NBRC 100599)
Sequence
MSVATAISVALLMANNQTIYAAAPPASNDYYLSNQLHLSQIRAQQAWAVVNSNEQIIIAV
LDSGADYKHPDLKDNLLPGVNLVNPGGSAQDDNGHGTEVTGVLAASGNNSIGVSGVLWNA
KILPIKVLAKNGDTTVQTLAKGINTALDRGAKVIVMSLSSMSYSKELANAVQRAERSGAV
LIAASGNESSRVAYPAAYPTVVAVGAVRSNNEVLYQSNTGPELNLVAPGFNVYTTKLGGR
YGSFSGTSAAAPQVAGAAALILARHPKLSPFDVRQLLYQTATDLGEKGWDRKTGYGLLNV
DKAVRTSLSYDFLEPNNQTYSAKAFPIESQIRGNLGPKDTIDWLKMDIPYDGKVSFTASV
TSGVSSAMAATFYPENRPPITQYFGNGDTITVPVKAGNMNIRLMRNGGVNNAFTYVLTSK
FTINPDRNEPNDTQETARPLVGNEISVTGNFHDEGDQDWFSYYVREYGHLDVAVSPDNKR
VDLLLSIGKQELGKKMVVWDPTYDNGTKDNPTERVQKEVSPGKYYIRVSEYNRNAVNGEY
QLDLGYTPVKKDFNEPNDTYQTASPLSGGTVMSGTIPTATDSDWFQFTVNSESYVTFRAP
YIPVDSGFRFALYSDRNMNYALASTNEVAELSKRGNDIIGLRLQPGKYYVRLNSGTSFKY
ESYRLTVTQQKLIAGYRDISDHWARSEIVRLSSRDIVNGFNDALFKPNQAVTRAEFATML
LKSMRATGSKVATTYTGKTTFRDMPKRHWAYHNLGVAYQLGILKGYPKNEMKPDQPISRA
EMAVMIARARNVLMYNHGTSNYRDVPTSHWASPAIEALTSRNWVNGYGSSFKPNGRATRA
EVVVVLSKAYQL
Download sequence
Identical sequences C0Z734
gi|226314991|ref|YP_002774887.1| 358681.BBR47_54060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]