SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 360107.CHAB381_0244 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  360107.CHAB381_0244
Domain Number - Region: 64-127
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0867
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 360107.CHAB381_0244
Sequence length 166
Comment (Campylobacter hominis ATCC BAA-381)
Sequence
MKIIFFIFLQGFNVNKYFLFFIFLIFTGCAFNTPKISKSINFTAISPLIKINDAGFLHKI
SGGDKIELYKSGVLVLELVDKNGKICLNGACDDELIFNQKFFKNAYYKGLLSEILNFKHI
FKGKNLTETNCGFTQIFDGIKYEICGGMLNFKDSKNGVKIKLKELN
Download sequence
Identical sequences A7I009
gi|154148806|ref|YP_001405850.1| 360107.CHAB381_0244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]