SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 360911.EAT1b_1099 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360911.EAT1b_1099
Domain Number 1 Region: 28-118
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000196
Family Collagen-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 263-368
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000379
Family Collagen-binding domain 0.003
Further Details:      
 
Domain Number 3 Region: 143-240
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000915
Family Collagen-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 360911.EAT1b_1099
Sequence length 458
Comment (Exiguobacterium AT1b)
Sequence
MSKIWKKGIASLLGMLLILSTMPLASAESSPKLLPLNTTVTGELSQIQTEETYTFTLPQT
GKLTLSIDSAVQDELYVNLKDSNEQSIFLDMENRIETERKKKEITLHLEAGTYYLKVNVY
DKAWNTVWKKFTITTEYTPVATDDAEPNNDTLTAQELMIGKSTKGFFSRQDSKDVHELRL
NEPGRLHISFLSEMDDINIRLMDSNETIAFEHQVTAFKGQIGKKDVEIDLEPGTYFLYIE
QGMFWDDTGVYQLETTFNPAHNQEAEPNNSPSQSVKFPFYTKQKGFLSWNDPIDLYRFDI
PKSSQVTIDLTTSIAEQVRVRVYSADGELYLSQPVYGSVKDPHQFLKTLLLPKGTYYFQI
EDYFGNDDTGVYDLIIKSNHLLPVLSINKVTTRSTKVSGKTEKGATVTMMLGKKSYKRKA
DSKGNYSFAINKQKAGTSIKISTKNKYGSTVKTVKVSR
Download sequence
Identical sequences C4L6T4
WP_012727146.1.32866 gi|229916826|ref|YP_002885472.1| 360911.EAT1b_1099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]