SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 361100.BCQ_0620 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  361100.BCQ_0620
Domain Number 1 Region: 855-964
Classification Level Classification E-value
Superfamily Collagen-binding domain 2.09e-30
Family Collagen-binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 733-850
Classification Level Classification E-value
Superfamily PKD domain 1.57e-18
Family PKD domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 361100.BCQ_0620
Sequence length 965
Comment (Bacillus cereus Q1)
Sequence
MNKKSKINKVMLSISTMALSLGALQAPASAEEKVPYNVLKTKPVGIEKPVDEIGHVSKAE
ETLSFQERLKVGDFSQRPASIPNKAAVKQVKESYSMADLNKMNDQELVETLGCIKWHQIT
DLFQFNEDAKAFYKDKGKMQVIIDELAHRGSTFTRDDSKGIQTFTEVLRSAFYLAFYNNE
LSELNERSFQDKCLPALKAIAKNPNFKLGTAEQDTVVSAYGKLISNASSDVETVQYASNI
LKQYNDNFNTYVNDRMKGQAIYDIMQGIDYDIQSYLIEARKEANETMWYGKVDGFINEIN
RIALLNEVTPENKWLVNNGIYFASRLGKFHSNPNKGLEVVTQAMHMYPRLSEPYFVAVEQ
ITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGSIVFKTGDKVSEEKIKRLYWAA
KEVKAQYHRVIGNDKALEPGNADDILTIVIYNSPEEYQLNRQLYGYETNNGGIYIEETGT
FFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLFGRGDMYQNERLTWFQEGNAEFFA
GSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKYGSWDFYNYSFALQSYLYTHQFETF
DKIQDLIRANDVKNYDAYRENLSKDPKLNKEYQEYMQQLIDNQDKYNVPAVADDYLAEHA
PKSLTAVEKEMTETLPMKDAKMTKHSSQFFNTFTLEGTYTGSVTKGESEDWNAMSKKVNE
VLEQLAQKEWSGYKTVTAYFVNYRVNSSNEFEYDVVFHGIAKDDGENKAPTVNINGPYNG
LVKEGIQFKSDGSKDEDGKIVSYLWDFGDGRTSTEVNPVHVYEREGSYKVALIVKDDKGK
ESKSETTVTVKDGSLTESEPNNRPEEANRIGLNTTIKGSLIGGDHTDVYTFNVASAKDID
ISVLNEYGIGMTWVLHHESDMQNYAAYGQANGNHIEANFNAKPGEYYLYVYKYDNGDGTY
KLSVK
Download sequence
Identical sequences B9J3S4
gi|222094306|ref|YP_002528365.1| 361100.BCQ_0620 WP_001036386.1.10762 WP_001036386.1.13024 WP_001036386.1.20687 WP_001036386.1.24184 WP_001036386.1.29209 WP_001036386.1.33045 WP_001036386.1.3318 WP_001036386.1.3615 WP_001036386.1.37093 WP_001036386.1.37990 WP_001036386.1.44463 WP_001036386.1.49428 WP_001036386.1.50316 WP_001036386.1.50514 WP_001036386.1.54775 WP_001036386.1.54782 WP_001036386.1.56055 WP_001036386.1.57203 WP_001036386.1.57815 WP_001036386.1.57859 WP_001036386.1.58814 WP_001036386.1.60274 WP_001036386.1.64377 WP_001036386.1.70645 WP_001036386.1.77690 WP_001036386.1.81088 WP_001036386.1.82533 WP_001036386.1.84337 WP_001036386.1.93932 WP_001036386.1.95457 WP_001036386.1.95484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]